PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.F6MG1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 290aa    MW: 33162.6 Da    PI: 6.8654
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.F6MG1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.71.2e-149841798
                 E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                  +p+kf++++gg  +++  + l+ ++g +W+v+   ++++g ++++kGWkeF+    L+ g  + F+++g+s+f   v++f+
  Araip.F6MG1  9 KIPNKFTSKYGGGVKNP--VYLKPPDGTQWKVQW--TQHDGDILFEKGWKEFAAYYSLDHGHLLRFEFNGTSCF--EVHIFD 84
                 69********5554455..***************..**************************************..888887 PP

2B337.54.3e-12201283994
                  HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
           B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                  ++l+++r  +  +f  ++ ++ke++++++    +g+ W  kl       + ++++GW+ F  +n+Lk+gD++vF+l++ ++  l  
  Araip.F6MG1 201 SNLQRSRANFKASFYIKYFENKEQNVEIR---YEGKLWPAKLLCYPAAAAAYISNGWRPFSLENDLKVGDVCVFELISGENPVLDA 283
                  55666777788899999988889988888...689*******88999999*************************99765554555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.534186IPR003340B3 DNA binding domain
SMARTSM010198.2E-6486IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.4E-18886IPR015300DNA-binding pseudobarrel domain
PfamPF023629.7E-12984IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-17986IPR015300DNA-binding pseudobarrel domain
CDDcd100173.94E-121084No hitNo description
Gene3DG3DSA:2.40.330.107.3E-18186289IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-16187289IPR015300DNA-binding pseudobarrel domain
CDDcd100175.31E-13192287No hitNo description
SMARTSM010196.1E-7194289IPR003340B3 DNA binding domain
PfamPF023627.7E-10202287IPR003340B3 DNA binding domain
PROSITE profilePS5086310.842231289IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MSGSFALQKI PNKFTSKYGG GVKNPVYLKP PDGTQWKVQW TQHDGDILFE KGWKEFAAYY  60
SLDHGHLLRF EFNGTSCFEV HIFDMSGLEI HYPFNNRIDN DSVETLNELP PQCWGREQKR  120
LKTPLSLSLP FTSKQLRIAT ETRDVEGGSQ PEEKNIEMPI IPSVIHRSDV FEPGTCGFRC  180
LEEAQKFNSE NPSFMIKLGK SNLQRSRANF KASFYIKYFE NKEQNVEIRY EGKLWPAKLL  240
CYPAAAAAYI SNGWRPFSLE NDLKVGDVCV FELISGENPV LDAHIYRANG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016179043.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-29B3 family protein